DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Ser6

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:108/258 - (41%) Gaps:45/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GYNNG------ESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLL------ 254
            |..||      ::|..:||..|:|.: .|:..|||:::....:||:||.|.|...:.::      
  Fly    26 GKLNGRVVGGEDAVKNQFPHQVSLRN-AGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAE 89

  Fly   255 ---VRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPP 316
               :|||..|..|...|     ..::|:..||.:.|  ..||:||:.||.|..::..||||.||.
  Fly    90 RFTIRAGSNDRFSGGVL-----VQVAEVIVHEEYGN--FLNDVALLRLESPLILSASIQPIDLPT 147

  Fly   317 PETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPS 381
            .:||      .....:.:||| |......:...|:...|.::..:.|:.|:.....|....||. 
  Fly   148 VDTP------ADVDVVISGWG-RIKHQGDLPRYLQYNTLKSITRQQCEELIDFGFEGELCLLHQ- 204

  Fly   382 FTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444
                   .....|.||.|.|...       ..||||:..:.::......|..|..|.|.::||
  Fly   205 -------VDNGACNGDSGGPAVY-------NNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 66/247 (27%)
Tryp_SPc 207..444 CDD:214473 64/245 (26%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 64/251 (25%)
Tryp_SPc 32..256 CDD:238113 66/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457454
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.