DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG14227

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:278 Identity:73/278 - (26%)
Similarity:115/278 - (41%) Gaps:41/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 FLLKG-CGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVF 246
            |||.. ||.|.|.........|.:..:.....||:|::: :.|...|.|:||:.:.|||:||.||
  Fly    25 FLLDAECGRSLPTNAKLTWWNYFDSSTDIQANPWIVSVI-VNGKAKCSGSLINHRFVLTAAHCVF 88

  Fly   247 NRSEDSLLVRAGDWD-------LNSQTEL-HPYQMRAISELHRHENFNNLTLYN-DIALVVLERP 302
               .:::.|..||:|       .:|...| :.|.:| |.:...|..|..:.... ||.|:.::..
  Fly    89 ---REAMQVHLGDFDAWNPGQNCSSGARLSNAYCVR-IDKKIVHAGFGKIQAQQYDIGLLRMQHA 149

  Fly   303 FQVAPHIQPICL----PPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESC 363
            .|.:..::||||    |.....:.:         .|.||......|::..:||......:|.|.|
  Fly   150 VQYSDFVRPICLLINEPVAAIDRFQ---------LTVWGTTAEDFRSIPRVLKHSVGDRIDRELC 205

  Fly   364 QRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFC-TLPGQKDRYQLVGLVSWGI-ECA 426
            ....:..|...:..:|...:.|        |.||.|.|... .|.|...|....|::.:|: .||
  Fly   206 TLKFQQQVDESQICVHTETSHA--------CKGDSGGPFSAKILYGGTYRTFQFGIIIFGLSSCA 262

  Fly   427 EKDVPAAYTNVAYLRNWI 444
            ...|   .|||.:..:||
  Fly   263 GLSV---CTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/253 (26%)
Tryp_SPc 207..444 CDD:214473 63/251 (25%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/244 (26%)
Tryp_SPc 57..277 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.