DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG31827

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_723923.1 Gene:CG31827 / 318965 FlyBaseID:FBgn0051827 Length:294 Species:Drosophila melanogaster


Alignment Length:285 Identity:107/285 - (37%)
Similarity:160/285 - (56%) Gaps:23/285 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 QIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTL 232
            ||||             || |||.||..:..|.: ...|::..|||||.:|::. ..:.|.||:|
  Fly    25 QIEE-------------LK-CGYGNPDAVKVQFN-VTEGQAKPAEFPWTIAVIH-NRSLVGGGSL 73

  Fly   233 IHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALV 297
            |.|.:|||:||.:||:..:.::|.||:|:..|..|.:|::...:.::..|::||.....|::||:
  Fly    74 ITPDIVLTAAHRIFNKDVEDIVVSAGEWEYGSALEKYPFEEAFVLKMVIHKSFNYQRGANNLALL 138

  Fly   298 VLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRT-MENLLKRIELPAVDHE 361
            .|:|.|.:...|..|||     |..:..|.|..|:..||| :|..|.| ...:||:|:||.|...
  Fly   139 FLDREFPLTYKINTICL-----PTQKRSLSSTRCIVAGWG-KYQFSDTHYGGVLKKIDLPIVPRH 197

  Fly   362 SCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECA 426
            .||..||.|.||:.|.|.....||||.|..|.|.||||..|||.:.....:::.:|:|:||:.|.
  Fly   198 ICQDQLRKTRLGQNYTLPRGLICAGGEKDNDACTGDGGGALFCPMTEDPKQFEQIGIVNWGVGCK 262

  Fly   427 EKDVPAAYTNVAYLRNWIDEQVTKS 451
            ||:|||.||:|...:.||.:|:.::
  Fly   263 EKNVPATYTDVFEFKPWIVQQIKEN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 93/240 (39%)
Tryp_SPc 207..444 CDD:214473 91/237 (38%)
CG31827NP_723923.1 Tryp_SPc 50..283 CDD:238113 93/239 (39%)
Tryp_SPc 50..280 CDD:214473 91/236 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.