DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG32376

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:126/296 - (42%) Gaps:59/296 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 GYSNPKGLYYQLDGYNNGESV--------FAEFPWMVAL-------------------------- 219
            ||....|.:|.|  |...|.:        .:..|::.||                          
  Fly    20 GYYKDNGTHYLL--YGKPEDIAPTPNFGNISSNPFINALEAQESFPTRIVNGKRIPCTEAPFQGS 82

  Fly   220 MDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHEN 284
            :..||.||||..:|:...:|| ||:.|....:...||.|     |..:....|:|.:.::.....
  Fly    83 LHYEGYFVCGCVIINKIWILT-AHHCFFGPPEKYTVRVG-----SDQQRRGGQLRHVKKIVALAA 141

  Fly   285 FNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENL 349
            :|:.|:.:|:|::.|:.|......::|:.||..:|.:...:.     :.:|||:..:.::.::..
  Fly   142 YNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKF-----VVSGWGITSANAQNVQRY 201

  Fly   350 LKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQ 414
            |:|:::..:....||::.:...|    .::....||... .||:|.||.|.||       ..|..
  Fly   202 LRRVQIDYIKRSKCQKMYKKAGL----KIYKDMICASRT-NKDSCSGDSGGPL-------TSRGV 254

  Fly   415 LVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTK 450
            |.|:|||||.||.|:.|..|.|......||.:.:.|
  Fly   255 LYGIVSWGIGCANKNYPGVYVNCKRYVPWIKKVIHK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 66/273 (24%)
Tryp_SPc 207..444 CDD:214473 64/270 (24%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 60/241 (25%)
Tryp_SPc 66..287 CDD:238113 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457479
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.