DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss30

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:276 Identity:91/276 - (32%)
Similarity:137/276 - (49%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 DFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVF 246
            |.|...||:|...|   ::.|  ..:::..::||.|:|...|...:|||:|||...|||:|| .|
Mouse    59 DILPSVCGHSRDAG---KIVG--GQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAH-CF 117

  Fly   247 NRSEDSLL--VRAGDWDLNSQTELHPYQ-MRAISELHRHENFNNLTLY-----NDIALVVLERPF 303
            .||.:...  |:.|...|:.   |.|:. :.|:..:..|..:    |:     .|||||.|:.|.
Mouse   118 RRSLNPSFYHVKVGGLTLSL---LEPHSTLVAVRNIFVHPTY----LWADASSGDIALVQLDTPL 175

  Fly   304 QVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLR 368
            :.: ...|:|||..:||.....:    |..||||.  :..|.|.::|:.:.:|.:|.|.|:::. 
Mouse   176 RPS-QFTPVCLPAAQTPLTPGTV----CWVTGWGA--TQERDMASVLQELAVPLLDSEDCEKMY- 232

  Fly   369 HT----VLGRRYNLHPSFTCAGGVKG-KDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEK 428
            ||    :.|.|. :.....|||.|:| ||:|.||.|.||.|::   ...:..||:.||||.||..
Mouse   233 HTQGSSLSGERI-IQSDMLCAGYVEGQKDSCQGDSGGPLVCSI---NSSWTQVGITSWGIGCARP 293

  Fly   429 DVPAAYTNVAYLRNWI 444
            ..|..||.|....:||
Mouse   294 YRPGVYTRVPTYVDWI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 84/251 (33%)
Tryp_SPc 207..444 CDD:214473 82/249 (33%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.