DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Tpsg1

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:317 Identity:86/317 - (27%)
Similarity:126/317 - (39%) Gaps:86/317 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 FLL----KGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAH 243
            |||    .|||.........::.|.:..::  ..:||..:|. ::...||||:|:.|:.|||:||
  Rat     9 FLLLLAVPGCGQPQVSHAGSRIVGGHAAQA--GAWPWQASLR-LQKVHVCGGSLLSPEWVLTAAH 70

  Fly   244 NVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYN----------DIALVV 298
             .|:.|.:|           |..|:|..::......| ......:.:|:          |||||.
  Rat    71 -CFSGSVNS-----------SDYEVHLGELTITLSPH-FSTVKQIIMYSSAPGPPGSSGDIALVQ 122

  Fly   299 LERPFQVAPHIQPICLPPPET---PQMEAELRSASCLATGWGLRYSTSRTMEN-------LLKRI 353
            |..|..::..:||:|||....   |.|:       |..||||.      |.|.       .|:..
  Rat   123 LATPVALSSQVQPVCLPEASADFHPGMQ-------CWVTGWGY------TQEGEPLKPPYNLQEA 174

  Fly   354 ELPAVDHESCQR--------LLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQK 410
            ::..||.|:|.:        |::..:|           ||.|  ..|.|..|.|.||.|.:.|  
  Rat   175 KVSVVDVETCSQAYSSSNGSLIQSDML-----------CAWG--PGDACQDDSGGPLVCRVAG-- 224

  Fly   411 DRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKSG---------FPLIEG 458
             .:|..|:||||..|...|.|..|..|....|||...:.:.|         .||:.|
  Rat   225 -IWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHRHILEPGGSGMQGLSWIPLLAG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 75/267 (28%)
Tryp_SPc 207..444 CDD:214473 73/264 (28%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 74/272 (27%)
Tryp_SPc 30..260 CDD:238113 76/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346322
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.