DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss42

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:236 Identity:76/236 - (32%)
Similarity:117/236 - (49%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQ-TELHPYQMRA 275
            ::||.|:|. :....||||:|::.|.|||:||.:.:|.:.:  |:.||..:..| |.|    :..
  Rat    94 KWPWQVSLR-VRHMHVCGGSLLNSQWVLTAAHCIHSRVQYN--VKMGDRSVYRQNTSL----VIP 151

  Fly   276 ISELHRHENFNNLT-LYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGL- 338
            |..:..|..|:..| :.|||||:.|::|......|.|||: |..|..::|   ...|..||||. 
  Rat   152 IQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICV-PTGTFHVKA---GTKCWVTGWGKP 212

  Fly   339 RYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLF 403
            .....:....:|:.::...:.:|.|..:|:.........:.....||....|||.|.||.|.||.
  Rat   213 DPGAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCAYKEGGKDACQGDSGGPLS 277

  Fly   404 CTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444
            |..   .:|:..:|:|||||.|..|..|..||:||:...|:
  Rat   278 CEF---DNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 76/236 (32%)
Tryp_SPc 207..444 CDD:214473 75/234 (32%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 75/233 (32%)
Tryp_SPc 84..315 CDD:238113 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.