DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Tpsb2

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:295 Identity:93/295 - (31%)
Similarity:131/295 - (44%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 PLGDQIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNF-- 226
            ||...:.....|:::.|              |:   :.|....||   ::||.|:|. .:.:|  
  Rat    12 PLASLVHAAPCPVKQRV--------------GI---VGGREASES---KWPWQVSLR-FKFSFWM 55

  Fly   227 -VCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTL 290
             .|||:|||||.|||:||.|....:...|.|.   .|..|...:..|:..::....|.::..:..
  Rat    56 HFCGGSLIHPQWVLTAAHCVGLHIKSPELFRV---QLREQYLYYADQLLTVNRTVVHPHYYTVED 117

  Fly   291 YNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENL-LKRIE 354
            ..||||:.||.|..|:.||.|..|||..    |......||..||||...|....:... ||:::
  Rat   118 GADIALLELENPVNVSTHIHPTSLPPAS----ETFPSGTSCWVTGWGDIDSDEPLLPPYPLKQVK 178

  Fly   355 LPAVDHESCQRLLRHTVLGRRYN------LHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRY 413
            :|.|::..|.|.. ||.|   |.      :.....|||..: .|:|.||.|.||.|.:.|   .:
  Rat   179 VPIVENSLCDRKY-HTGL---YTGDDVPIVQDGMLCAGNTR-SDSCQGDSGGPLVCKVKG---TW 235

  Fly   414 QLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            ...|:||||..|||.:.|..||.|.|..:||...|
  Rat   236 LQAGVVSWGEGCAEANRPGIYTRVTYYLDWIHRYV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 86/249 (35%)
Tryp_SPc 207..444 CDD:214473 84/246 (34%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 87/259 (34%)
Tryp_SPc 30..266 CDD:214473 85/257 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346327
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.