DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss29

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:297 Identity:89/297 - (29%)
Similarity:144/297 - (48%) Gaps:60/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 IQRNVKDFLLKGC--GYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNF-----VCGGTLI 233
            |..:|.:.:|.|.  |.|.|:|                ::||.|:|.....|:     :|||::|
  Rat    19 IPASVPEDVLVGIVGGNSAPQG----------------KWPWQVSLRVYRYNWASWVHICGGSII 67

  Fly   234 HPQLVLTSAHNVFNRSED--SLLVRAGDWDLNSQTELHPY---QMRAISELHRHENFNNLTLYND 293
            |||.|||:||.:.....|  :..:..|        :::.|   ::..:|.:..|.:|....|.:|
  Rat    68 HPQWVLTAAHCIHESDADPSAFRIYLG--------QVYLYGGEKLLKVSRVIIHPDFVRSGLGSD 124

  Fly   294 IALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTM-ENL-----LKR 352
            :||:.|.:..:..|:::|:.|.|......:.::    |..||||     |.:| |:|     |::
  Rat   125 VALLQLAQSVRSFPNVKPVKLSPASLEVTKKDV----CWVTGWG-----SVSMHESLPPPYRLQQ 180

  Fly   353 IELPAVDHESCQRLLRHTVL----GRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRY 413
            :::..||:..|::|.|:...    |:|..|. ...|||. .|:|:|.||.|.||.|.:.|.   :
  Rat   181 VQVKIVDNTLCEKLYRNATRLSNHGQRLILQ-DMLCAGS-HGRDSCYGDSGGPLVCNVTGS---W 240

  Fly   414 QLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTK 450
            .|||:||||..||.||:|..|..|.:...||..|:.|
  Rat   241 TLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQMQK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 79/259 (31%)
Tryp_SPc 207..444 CDD:214473 77/256 (30%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.