DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG33226

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_995917.3 Gene:CG33226 / 2768859 FlyBaseID:FBgn0069056 Length:292 Species:Drosophila melanogaster


Alignment Length:283 Identity:84/283 - (29%)
Similarity:124/283 - (43%) Gaps:40/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 KDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNV 245
            :|.|...| ...|.|:..|:.|.:|.:  ....||||.:: ..|...|||:||....|||:||  
  Fly    29 QDLLDPNC-VQTPVGVREQILGGHNAD--IKLHPWMVQIL-QRGYHFCGGSLISSLFVLTAAH-- 87

  Fly   246 FNRSEDSLLVRAGDWD------LNSQTELHPYQMRA-ISELHRHENFNNLTLYNDIALVVLERPF 303
             ..|...|.||.|.:.      |.|.....|:.... :..:..|.::.:...| ||||.:|.:|.
  Fly    88 -CHSRYRLKVRFGRYSGITPRYLCSSQYCSPFGPEIDVKRIFLHSSYRDYHNY-DIALFLLAKPV 150

  Fly   304 QVAPHIQPICLPPPETPQMEAELRS-----ASCLATGWGLRYSTSRTMENLLKRIELPAVDHESC 363
            :.....:|||:  .:|...: :||.     |....||||  .:.|:....:|:...|..:|.:.|
  Fly   151 RYNVQTRPICV--LQTSNKD-KLRQFLNYVAMFNVTGWG--KTESQLTSTILQTTSLFHLDRKFC 210

  Fly   364 QRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFC--TLPGQKDRYQLVGLVSWGI-EC 425
            .::....: |..:      .|||..: ..||.||.|.||..  |..|.| |..|.|::|:|. .|
  Fly   211 AQIFDRKI-GWPH------ICAGHSQ-SSTCTGDSGGPLSAELTFSGVK-RTVLFGIISYGAPNC 266

  Fly   426 AEKDVPAAYTNVAYLRNWIDEQV 448
            .|..|   :|||....|||.:.|
  Fly   267 REVTV---FTNVLRYSNWIRDIV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 75/254 (30%)
Tryp_SPc 207..444 CDD:214473 73/251 (29%)
CG33226NP_995917.3 Tryp_SPc 47..285 CDD:238113 77/261 (30%)
Tryp_SPc 47..282 CDD:214473 75/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.