DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss45

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_694812.1 Gene:Prss45 / 260408 MGIID:3605764 Length:317 Species:Mus musculus


Alignment Length:261 Identity:75/261 - (28%)
Similarity:117/261 - (44%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 FPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHP----YQM 273
            :||..:| .:|...||||.||....|:::||.:....|.|::       |.|.| |||    :.:
Mouse    61 WPWEASL-QIEDKHVCGGALIDRSWVVSAAHCIQGNKEYSVM-------LGSST-LHPNGSSWTL 116

  Fly   274 R-AISELHRH-----ENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELR---SA 329
            : .:.::..|     .||    :.:||||:.||.|.....::||||||       |....   ..
Mouse   117 KIPVGDIIIHPKYWGRNF----IRSDIALLCLETPVTFNKYVQPICLP-------EHNFNFKVGT 170

  Fly   330 SCLATGWG--LRYSTSR-TMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHP--------SFT 383
            .|..||||  .::|::: |....|...|:..:|:::|..:.      .:..|:|        :..
Mouse   171 KCWVTGWGQVKQHSSAQLTPAPELWEAEVFIIDNKNCDSIF------HKKTLYPQVVPLIRKNMI 229

  Fly   384 CAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            |.... |:|.|.||.|.||.|.:.|   |:.|.|:.||...||.....:.||.:.....||.:||
Mouse   230 CTTNY-GEDLCYGDPGGPLACEIDG---RWILAGVFSWEKACATVPNLSVYTRITKYTIWIKDQV 290

  Fly   449 T 449
            :
Mouse   291 S 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 73/257 (28%)
Tryp_SPc 207..444 CDD:214473 71/254 (28%)
Prss45NP_694812.1 Tryp_SPc 59..289 CDD:238113 73/257 (28%)
Tryp_SPc 59..286 CDD:214473 71/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.