DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG30289

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_726081.1 Gene:CG30289 / 246532 FlyBaseID:FBgn0050289 Length:316 Species:Drosophila melanogaster


Alignment Length:290 Identity:88/290 - (30%)
Similarity:128/290 - (44%) Gaps:73/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 LLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNR 248
            |::.||.|  |...|..:.:...::...|.||||.:...:   .|||:||..|.|||:||.|   
  Fly    26 LVENCGIS--KDDPYVPNIFGGAKTNIQENPWMVLVWSSK---PCGGSLIARQFVLTAAHCV--- 82

  Fly   249 SEDSLLVRAGDWDLNSQTELHPYQM--RAISELHR--------HENFNNLTLYNDIALVVLERPF 303
            |.:.|.||.||::   ..:..||.:  ..|.:.:.        |||:|.:||.|||||:.:....
  Fly    83 SFEDLYVRLGDYE---TLDPMPYCLNNHCIPKFYNISVDMKIVHENYNGITLQNDIALLRMSEAV 144

  Fly   304 QVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLR 368
            :.:.:::||||...|  ||::   ......||||                   ..::....|:|.
  Fly   145 EYSDYVRPICLLVGE--QMQS---IPMFTVTGWG-------------------ETEYGQFSRILL 185

  Fly   369 HTVLGRRYNLHPSF-------------TCAGGVKGKDTCMGDGGSPLFCTLPGQKDRY--QLV-- 416
            :..|   ||:..|:             .|||. ...:||.||.|.||     ..|..|  :|:  
  Fly   186 NATL---YNMDISYCNIKFNKQADRSQICAGS-HTSNTCKGDSGGPL-----SSKFHYGNRLLSF 241

  Fly   417 --GLVSWGIECAEKDVPAAYTNVAYLRNWI 444
              ||||:|.|....:|...||||:|.|.||
  Fly   242 QYGLVSYGSERCAANVAGVYTNVSYHREWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 82/267 (31%)
Tryp_SPc 207..444 CDD:214473 80/265 (30%)
CG30289NP_726081.1 Tryp_SPc 42..271 CDD:214473 80/270 (30%)
Tryp_SPc 42..271 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.