DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG30288

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001097398.1 Gene:CG30288 / 246531 FlyBaseID:FBgn0050288 Length:282 Species:Drosophila melanogaster


Alignment Length:315 Identity:89/315 - (28%)
Similarity:135/315 - (42%) Gaps:81/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 VVEECCPLG-DQIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEF-PWMVALM 220
            |:..|..:| .:.|.||         .|...||.::..|...::||   |.....|. ||||.:|
  Fly     9 VIVACLFIGIIRTESGR---------LLENDCGTTSSNGYRARIDG---GRDAGMESNPWMVRVM 61

  Fly   221 DMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTELHP-------------YQ 272
             :.|..||||:||..:.|||:.|.:   |...:.||.|::|..     ||             |.
  Fly    62 -ISGKAVCGGSLITARFVLTAEHCI---SPMYMNVRLGEYDTR-----HPIFDCDDFVCTPRAYN 117

  Fly   273 M---RAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPET----PQMEAELRSAS 330
            :   |.|  :|.:..:       ||.|:.::|....:.:::||||...:|    |        .|
  Fly   118 VDVDRKI--VHSNPGY-------DIGLLRMQRSVIFSNYVRPICLILGKTLGGNP--------LS 165

  Fly   331 CLA---TGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKD 392
            .|.   ||||.  ::....::.|:...|..:...||:|      .||..::  |:.|||... .|
  Fly   166 ILRFNFTGWGT--NSDGEEQDRLQTATLQQLPQWSCER------PGRPLDI--SYICAGSYI-SD 219

  Fly   393 TCMGDGGSPLFC--TLPGQKDRYQLVGLVSWGIE-CAEKDVPAAYTNVAYLRNWI 444
            :|.||.|.||..  |..||...:|. |:.|.|:. |:...:   ||||.:..:||
  Fly   220 SCKGDSGGPLSAIRTFEGQGRVFQF-GVASQGLRLCSGLGI---YTNVTHFTDWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 76/265 (29%)
Tryp_SPc 207..444 CDD:214473 74/263 (28%)
CG30288NP_001097398.1 Tryp_SPc 42..270 CDD:214473 77/271 (28%)
Tryp_SPc 45..270 CDD:238113 76/268 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.