DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG30287

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_726083.1 Gene:CG30287 / 246530 FlyBaseID:FBgn0050287 Length:284 Species:Drosophila melanogaster


Alignment Length:285 Identity:91/285 - (31%)
Similarity:126/285 - (44%) Gaps:59/285 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SNPKGLYYQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLV 255
            |.| |||..::|  ....:|:. ||||.::: .|...|||:||.|:.|||:|| ..:.::..|.|
  Fly    35 SEP-GLYRVING--KPADLFSN-PWMVIIIE-RGMMKCGGSLITPRYVLTAAH-CKSETKSQLTV 93

  Fly   256 RAGDWDLNSQTELHPY----QMRAISELH-----RHENFNNLTLYNDIALVVLERPFQVAPHIQP 311
            |.||:|:|...:...|    :.|.|:...     .:.||..    |||||:.||...|...:|:.
  Fly    94 RLGDYDVNQAVDCSSYGCIPRPREINVTRTYVPSHYTNFRK----NDIALLRLETTVQYGDNIRS 154

  Fly   312 ICLPPPETPQMEAELRSASCL-------ATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRH 369
            |||      .|.....|::.|       .||||...|          ||..|.:...|   |..|
  Fly   155 ICL------LMGDYTWSSNILKNLVKFNTTGWGRTES----------RINSPVLQQAS---LTHH 200

  Fly   370 ------TVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLP-GQKDRYQLVGLVSWG-IECA 426
                  .|.|::  |..|..|.....| .||.||.|.||...:. |.:.|..|.|:||:| :.|.
  Fly   201 HLSYCAQVFGKQ--LDKSHICVASSTG-STCQGDSGGPLTARVRIGSERRVILFGVVSYGAVHCF 262

  Fly   427 EKDVPAAYTNVAYLRNWIDEQVTKS 451
            .   |..||||.:..|||:....|:
  Fly   263 G---PTVYTNVIHFANWIELHTKKN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 84/263 (32%)
Tryp_SPc 207..444 CDD:214473 82/260 (32%)
CG30287NP_726083.1 Tryp_SPc 41..277 CDD:214473 83/269 (31%)
Tryp_SPc 42..280 CDD:238113 85/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.