DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG30082

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:241 Identity:72/241 - (29%)
Similarity:110/241 - (45%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 PWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLLVRAGDWDLNSQTE------LHPYQ 272
            ||: |.:....:.||.||||..:.|||:||.:  .|...|.||.|::|.:::.:      :..|:
  Fly    52 PWL-AYLHKNSSLVCTGTLITKRFVLTAAHCL--HSFHLLTVRLGEYDTSTRIDCTSEFCIPTYE 113

  Fly   273 MRAISELHRHENF-NNLTLYNDIALVVLERPFQVAPHIQPICL--PPPETPQMEAELRSASCLAT 334
            ..::...:.|..| ......|||.|:.|.........|:||||  .|.:.|.      |::..|.
  Fly   114 EYSVENAYIHTFFGGRQDSRNDIGLLKLNGTVVYKLFIRPICLFRDPGQVPY------SSTYEAA 172

  Fly   335 GWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGG 399
            ||| :.....| ..:|:.:.|..:|...|:|.||.::...::       |||..:. |||.||.|
  Fly   173 GWG-KIDLINT-ATVLQTVNLIRLDQSDCERSLRTSLSYGQF-------CAGQWRA-DTCSGDSG 227

  Fly   400 SPLFCTLP-GQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444
            .||...:. |:..|...:|:||:|......  |..||.|....|||
  Fly   228 GPLSRKMSNGRITRTVQLGIVSYGHYLCRG--PGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 72/241 (30%)
Tryp_SPc 207..444 CDD:214473 70/239 (29%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 70/239 (29%)
Tryp_SPc 40..274 CDD:238113 72/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.