DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss40

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_033382.2 Gene:Prss40 / 21756 MGIID:1270857 Length:365 Species:Mus musculus


Alignment Length:275 Identity:85/275 - (30%)
Similarity:126/275 - (45%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 CGYSNPKGLYYQLDGYNNGESVFAE-FPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSED 251
            ||.:..:|..|      .|:...|| :||..:|. :.|..:||..||....||::|| .|.||::
Mouse    60 CGKTKFQGKIY------GGQIAGAERWPWQASLR-LYGRHICGAVLIDKNWVLSAAH-CFQRSQE 116

  Fly   252 --SLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNNL-TLYNDIALVVLERPFQVAPHIQPIC 313
              ...|..|..||||.|...  :..::.::..|:::|.. |..:||.|:.|....:.:.||.|.|
Mouse   117 PSDYHVMLGYTDLNSPTRYS--RTMSVQKVIVHKDYNRFHTQGSDIVLLQLRSSVEYSSHILPAC 179

  Fly   314 LPPP--ETPQMEAELRSASCLATGWG-LRYSTSRTMENLLKRIELPAVDHESCQRLLRHTV--LG 373
            :|..  :.|:.:|      |.|:||| ||......:.|.|...||..:.::.|:......|  .|
Mouse   180 VPEENIKIPKEKA------CWASGWGYLREDVRIPLPNELYEAELIIMSNDQCKGFFPPPVPGSG 238

  Fly   374 RRYNLHPSFTCAGGV-KGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDV-PAAYTN 436
            |.|.::....||... ..|..|.||.|.||.|.|.|.   :.:|||.||...|.|..| |:.:..
Mouse   239 RSYYIYDDMVCAADYDMSKSICAGDSGGPLVCLLEGS---WYVVGLTSWSSTCEEPIVSPSVFAR 300

  Fly   437 VAYLRNWIDEQVTKS 451
            |:|...||.:....|
Mouse   301 VSYFDKWIKDNKKSS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 79/250 (32%)
Tryp_SPc 207..444 CDD:214473 77/247 (31%)
Prss40NP_033382.2 Tryp_SPc 68..308 CDD:214473 79/258 (31%)
Tryp_SPc 69..311 CDD:238113 81/260 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..343 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.