DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and CG12256

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:291 Identity:75/291 - (25%)
Similarity:126/291 - (43%) Gaps:64/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 SNPKGLYYQLDGY------NNGESVFAEF--------PWMVAL--MDMEGNF--VCGGTLIHPQL 237
            |.|.|....||.|      |:.|.|...:        |:.|::  :...|..  .|||:||.|..
  Fly    23 SKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNR 87

  Fly   238 VLTSAHNVFNRSEDSLLVRAGDWDLNS----QTELHPYQMRAISELHRHENFNNLTLYNDIALVV 298
            |||:||.|..::...:.|.||..|||.    ::::..|:|        :||:..| :.:|||::.
  Fly    88 VLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEM--------NENYQEL-VTSDIAILK 143

  Fly   299 LERPFQV-APHIQPICLPPPETPQMEAELRSASCLATGWG----------LRYSTSRTMENLLKR 352
            ::.||:: ...:..|.:...:....:.|:     |.||||          .:|.|      :|::
  Fly   144 IDPPFELDEKRVSTIDVSGSDMVGADQEV-----LLTGWGSVFHFGTGPFAKYPT------VLQK 197

  Fly   353 IELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVG 417
            ::...:.:..|:..:.        .|..:..||....||..|.||.|.||   :....:.|:.||
  Fly   198 LDYKTLSNSKCKETMT--------QLTDTEICALERFGKGACNGDSGGPL---VMKSGESYKQVG 251

  Fly   418 LVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            :||:|......:.|..||.|:....||.|::
  Fly   252 VVSYGTAFCASNNPDVYTRVSMFDGWIKERM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 67/266 (25%)
Tryp_SPc 207..444 CDD:214473 65/263 (25%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 64/262 (24%)
Tryp_SPc 47..280 CDD:238113 66/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.