DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and LOC1275424

DIOPT Version :10

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_061518081.1 Gene:LOC1275424 / 1275424 VectorBaseID:AGAMI1_005761 Length:568 Species:Anopheles gambiae


Alignment Length:34 Identity:14/34 - (41%)
Similarity:17/34 - (50%) Gaps:0/34 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PKARLHDNISSLEGKQLTLGGFTEKFDEARIRQI 75
            |.:.|.||:|..|..:|.|..|.|....|.||.|
Mosquito    87 PISALIDNLSKGEQLKLQLPDFVEYDLHAAIRTI 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 CLIP_1 112..163 CDD:465709
Tryp_SPc 207..447 CDD:238113
LOC1275424XP_061518081.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.