DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss29

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:283 Identity:89/283 - (31%)
Similarity:141/283 - (49%) Gaps:37/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 GCGYS-----NPKGLYYQLDGYNNGESV-FAEFPWMVALMDMEGNFV-----CGGTLIHPQLVLT 240
            ||..:     .|:|:   |.|...|.|. ..::||.|:|......:.     |||::||||.|||
Mouse    13 GCSIAGTPAPGPEGV---LMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLT 74

  Fly   241 SAHNVFNRSEDSLL--VRAGDWDLNSQTELHPYQMRAISELHRHENFNNLTLYNDIALVVLERPF 303
            :||.:..|..|..:  :|.|:..|....||     .::|.:..|.:|.:..|.:|:||:.|....
Mouse    75 AAHCIRERDADPSVFRIRVGEAYLYGGKEL-----LSVSRVIIHPDFVHAGLGSDVALLQLAVSV 134

  Fly   304 QVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTM--ENLLKRIELPAVDHESCQRL 366
            |..|:::|:.||   :..:|...:.. |..|||| ..||.|::  ...|:::::..:|:..|:.:
Mouse   135 QSFPNVKPVKLP---SESLEVTKKDV-CWVTGWG-AVSTHRSLPPPYRLQQVQVKIIDNSLCEEM 194

  Fly   367 ----LRHTVLGRRYNLHPSFTCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAE 427
                .||...|::..| ....|||. :|:|:|.||.|.||.|.:.|.   :.|||:||||..||.
Mouse   195 YHNATRHRNRGQKLIL-KDMLCAGN-QGQDSCYGDSGGPLVCNVTGS---WTLVGVVSWGYGCAL 254

  Fly   428 KDVPAAYTNVAYLRNWIDEQVTK 450
            :|.|..|..|.....||.:|:.:
Mouse   255 RDFPGVYARVQSFLPWITQQMQR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 81/253 (32%)
Tryp_SPc 207..444 CDD:214473 79/250 (32%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 82/257 (32%)
Tryp_SPc 31..271 CDD:214473 80/254 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.