DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss28

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:261 Identity:71/261 - (27%)
Similarity:124/261 - (47%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EFPWMVAL--MDMEGN---FVCGGTLIHPQLVLTSAHNVFNRSEDSLL--VRAGDWDLNSQTELH 269
            ::||.|:|  ...|.|   .:|||::||||.:||:||.:.::..|..:  |:.|:..|..:.|| 
Mouse    41 KWPWQVSLRMYSYEVNSWVHICGGSIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQEL- 104

  Fly   270 PYQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLAT 334
                ..||.:..|.::|:::...|:||:.|......:.::.|:.||...:.....:    .|...
Mouse   105 ----LNISRIIIHPDYNDVSKRFDLALMQLTALLVTSTNVSPVSLPKDSSTFDSTD----QCWLV 161

  Fly   335 GWGLRYSTSRTMENLLKR-----------IELPAVDHESCQRLLR------HTVLGRRYNLHPSF 382
            |||          |||:|           :::|..|::||:|..|      |..:.    :....
Mouse   162 GWG----------NLLQRVPLQPPYQLHEVKIPIQDNKSCKRAYRKKSSDEHKAVA----IFDDM 212

  Fly   383 TCAGGVKGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQ 447
            .|| |..|:..|.||.|.||.|   .:.:::..||:||.||:|: .::|:.::.|.....||.:.
Mouse   213 LCA-GTSGRGPCFGDSGGPLVC---WKSNKWIQVGVVSKGIDCS-NNLPSIFSRVQSSLAWIHQH 272

  Fly   448 V 448
            :
Mouse   273 I 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/258 (28%)
Tryp_SPc 207..444 CDD:214473 69/255 (27%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 71/258 (28%)
Tryp_SPc 31..269 CDD:214473 69/255 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.