DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and Prss48

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:263 Identity:77/263 - (29%)
Similarity:121/263 - (46%) Gaps:49/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFNRSEDSLL--VRAGDWDLNSQTELHP 270
            :....:||.|:|. .:...:|||:||....|:|:||.: .::..|.|  |..|..|.:..:....
  Rat    46 AALGHWPWQVSLR-FDSTHICGGSLISNHWVMTAAHCI-KKTWFSFLYSVWLGSIDRDYSSTGEE 108

  Fly   271 YQMRAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLP----PPETPQMEAELRSASC 331
            |.:..|....:|.|.:     .||||:.|.........:.|||||    |...|        |||
  Rat   109 YYVSRIVIPSKHHNTD-----GDIALLKLSSRVTFTSLVLPICLPNISKPLTVP--------ASC 160

  Fly   332 LATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYN------------LHPSFTC 384
            ..||||  .:......:.|:.:|:|.:..|:|::|         ||            :.....|
  Rat   161 WVTGWG--QNQEGHYPSTLQELEVPIITGEACEQL---------YNPIGFFLPDLERIIKEDMLC 214

  Fly   385 AGGV-KGKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQV 448
            ||.: :.||:|.||.|.||.|.:.|.   :..:|::|||:||. |::|..||||.|.:.||...:
  Rat   215 AGEIQQSKDSCKGDSGGPLSCHIDGV---WTQIGVISWGLECG-KNLPGVYTNVTYYQKWISSII 275

  Fly   449 TKS 451
            :::
  Rat   276 SRA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 77/257 (30%)
Tryp_SPc 207..444 CDD:214473 75/254 (30%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8953
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.