DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:316 Identity:85/316 - (26%)
Similarity:136/316 - (43%) Gaps:40/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TGVVNEDGRYIIKPRINEESNFGCRVVEECCPLGDQIEEGRNPIQRNVKDFLLKGCGYSNPKGLY 197
            |..||..||::.  |::..|    .|...|.....|..:..:...          ||........
Zfish   258 TSNVNVKGRWVF--RVDNSS----EVKGSCINTNSQALDSPSAAV----------CGIIPVNSSN 306

  Fly   198 YQLDGYNNGESVFAEFPWMVALMDMEGNFVCGGTLIHPQLVLTSAHNVFN--RSEDSLLVRAGDW 260
            ..:.|.|   |....:||..:|....|. .|||:||:.:.||::|| .||  |:...|.|..|. 
Zfish   307 GTVGGQN---SSAVHWPWQASLYWYSGQ-TCGGSLINKEWVLSAAH-CFNGQRNGFYLTVILGP- 365

  Fly   261 DLNSQTELHPYQM-RAISELHRHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEA 324
              .:|.:..|.:: |::..:.:|..:|..|..||||||.|..|......|:|:|| ..|.....:
Zfish   366 --KTQNKYDPSRISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCL-AAEGSVFNS 427

  Fly   325 ELRSASCLATGWGLRYSTSRTMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK 389
            :  :.|.:.|...:..........:.:.:|:|.:.:..|..|..   :|   ::..:..|||.:|
Zfish   428 D--TESWITTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYG---VG---SITDNMICAGLLK 484

  Fly   390 -GKDTCMGDGGSPLFCTLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWI 444
             |||.|.||.|.|:   :..|...:...|:||:|..||:.:.|..||.|:..:.||
Zfish   485 EGKDLCQGDSGGPM---VSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 71/242 (29%)
Tryp_SPc 207..444 CDD:214473 69/240 (29%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035 6/15 (40%)
Tryp_SPc 309..537 CDD:238113 71/247 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.