DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and zgc:165423

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:311 Identity:81/311 - (26%)
Similarity:138/311 - (44%) Gaps:59/311 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GCRVVEECCPLGDQIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVAL 219
            ||    :|.|.......|:.|:  |.|                  :.|..|..:  ..:||..:|
Zfish    17 GC----DCQPTQSPPACGKAPL--NTK------------------IVGGTNASA--GSWPWQASL 55

  Fly   220 MDMEGNFVCGGTLIHPQLVLTSAHNVF----NRSEDSLLVRAGDWDLNSQTELHPYQMRAISELH 280
            .: .|:..|||:||..|.:|::|| .|    |.|:.::.:.....||.:..|:    .:::|::.
Zfish    56 HE-SGSHFCGGSLISDQWILSAAH-CFPSNPNPSDYTVYLGRQSQDLPNPNEV----SKSVSQVI 114

  Fly   281 RHENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWG-LRYSTSR 344
            .|..:...|..||:||:.|..|...:.:|||:||...     .:...:.:...|||| :....|.
Zfish   115 VHPLYQGSTHDNDMALLHLSSPVTFSNYIQPVCLAAD-----GSTFYNDTMWITGWGTIESGVSL 174

  Fly   345 TMENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK-GKDTCMGDGGSPL----FC 404
            ....:|:.:.:|.|.:..|     :.:.|...::..:..|||.:: |||:|.||.|.|:    |.
Zfish   175 PSPQILQEVNVPIVGNNLC-----NCLYGGGSSITNNMMCAGLMQGGKDSCQGDSGGPMVIKSFN 234

  Fly   405 TLPGQKDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKSGFPL 455
            |       :...|:||:|..||:.:.|..|..|:..:|||.:.|..|..|:
Zfish   235 T-------WVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQYVRASFIPV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 68/249 (27%)
Tryp_SPc 207..444 CDD:214473 66/246 (27%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 69/272 (25%)
Tryp_SPc 38..269 CDD:238113 70/255 (27%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.