DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8738 and LOC100004427

DIOPT Version :9

Sequence 1:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster
Sequence 2:XP_005163955.1 Gene:LOC100004427 / 100004427 -ID:- Length:302 Species:Danio rerio


Alignment Length:315 Identity:77/315 - (24%)
Similarity:125/315 - (39%) Gaps:68/315 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 GCRVVEECCPLGDQIEEGRNPIQRNVKDFLLKGCGYSNPKGLYYQLDGYNNGESVFAEFPWMVAL 219
            ||....:.|        ||.|:...:                   :.|.|..|   ..:||..::
Zfish    19 GCLGQSDVC--------GRAPLNTKI-------------------VGGLNATE---GSWPWQASI 53

  Fly   220 -MDMEGNFVCGGTLIHPQLVLTSAHNVFNR-SEDSLLVRAGDWDLNSQTELHPYQM-RAISELHR 281
             ....|.|.|.|:||..:.|||:| :.|.| :...:::..|....|..   :||:: |.:.:   
Zfish    54 NFKSTGQFFCSGSLISERWVLTAA-SCFQRINVSDVVIYLGRLTTNGS---NPYEIPRTVIQ--- 111

  Fly   282 HENFNNLTLYNDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTM 346
                  :::..|||||.|........:|:|:||....:..::    ......||||...||:..:
Zfish   112 ------VSVTEDIALVQLSSSVTFTDYIRPVCLAAAGSVFVD----GTESWVTGWGSTSSTNVIL 166

  Fly   347 ENLLKRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVK--GKDTCMGDGGSPLFCTLPGQ 409
            .::||.:|.|.|::..|..:...|.|       .:..|||.|.  ||..|..|.||||   :..|
Zfish   167 SDMLKEVEAPIVNNIECSNINGITNL-------DNVICAGFVNETGKAPCWEDFGSPL---VTRQ 221

  Fly   410 KDRYQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDEQVTKS-----GFPLIEGF 459
            ..::...|:|.:.. |.:...|..|..|:....||....:.|     .:|:|..|
Zfish   222 GSQWIQSGVVVFTF-CGQNGFPTLYARVSEYEEWIRNYTSSSLPGFLSYPVIYTF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 65/244 (27%)
Tryp_SPc 207..444 CDD:214473 63/241 (26%)
LOC100004427XP_005163955.1 Tryp_SPc 35..255 CDD:214473 65/269 (24%)
Tryp_SPc 36..257 CDD:238113 67/270 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587359
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.