DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and prss60.1

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:275 Identity:83/275 - (30%)
Similarity:128/275 - (46%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NPKGLIPDNDKFPYSEDVSIF-GEFPWMVG----IFTGRQEFLCGGTLIHPRLVVTTSHNLVNET 235
            |..||.|.|::.  ...|:.| |.:||.|.    |:.|.   .|||:||:...|:|.:|.|...|
Zfish    23 NVCGLAPLNNRI--VGGVNAFDGSWPWQVSLHSPIYGGH---FCGGSLINSEWVLTAAHCLPRIT 82

  Fly   236 VDTLVARAGDWDLNSLNEPYPHQGSR-IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLC 299
            ..:|:...|......:|   .::.:| :..|.:|..::..:..||||||.|...:..:.:|:|:|
Zfish    83 TSSLLVFLGKTTQQGVN---TYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRPVC 144

  Fly   300 LPPPES--PELTNQLLSVTCYATGWGTKEAGSD-KLEHVLKRINLPLVEREECQAKLRNTRLEAR 361
            |....|  |..|:.      :.||||..:.|.: ....:|:...:|:|..::|.|.|.:.     
Zfish   145 LAAQNSVFPNGTSS------WITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSG----- 198

  Fly   362 FRLRPSFICAG---GDPGKDTCKGDGGSPLFCQMPGEMDRYQLV----GIVSWGVECAVEDIPAV 419
             .:..:.||||   |  |:|||:||.|.|:       :.:..||    ||.|||..||....|.|
Zfish   199 -SVTNNMICAGLLQG--GRDTCQGDSGGPM-------VSKQCLVWVQSGITSWGYGCADPYSPGV 253

  Fly   420 YVNVPHLRGWIDEKI 434
            |..|...:.||:..|
Zfish   254 YTRVSQYQSWINSII 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 75/250 (30%)
Tryp_SPc 197..430 CDD:214473 73/247 (30%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 75/259 (29%)
Tryp_SPc 34..267 CDD:238113 77/261 (30%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.