DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss47

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_038952282.1 Gene:Prss47 / 680378 RGDID:1592951 Length:398 Species:Rattus norvegicus


Alignment Length:268 Identity:77/268 - (28%)
Similarity:123/268 - (45%) Gaps:44/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVN-----ETVDTLVARAGDWDLNSLNE 253
            ::.|::||...:.. |...|||..||....:|:|:|...|     |..:.|:..      |.|.:
  Rat    89 TLAGQWPWQASLLY-RGLHLCGAVLIDSHWLVSTAHCFRNKSQAPEDYEVLLGN------NQLYQ 146

  Fly   254 PYPH-QGSRIKEIIMHSEFDP-NSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVT 316
            ...| |...:..||.|.:|:. :|..:|||:|.|..|:....::.|.|||..:: :|:|.   .:
  Rat   147 KTKHTQKIPVNHIINHPDFEKFHSFGSDIAMLQLRLPVNFTSYVVPACLPSKDT-QLSNH---TS 207

  Fly   317 CYATGWG------------TKEAGSDKLE--------HVLKRINLPLVEREECQAKLRNTRL-EA 360
            |:.||||            ....|.:|.:        ..|:...:.::|.|.|.| |...|| ::
  Rat   208 CWITGWGMLSEDSKGKRSWRGSKGREKRKIRAKLLPPFSLQEGEVGIIENEFCNA-LYGQRLGQS 271

  Fly   361 RFRLRPSFICAGG-DPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVP 424
            |..:....:|||| ..||..|:||.|.||.|.   .:..:.|||:.|||::|.....|:|:..|.
  Rat   272 RNYVHEEMLCAGGLSTGKSICRGDSGGPLVCY---HISAWVLVGLASWGLDCRPSIYPSVFTRVT 333

  Fly   425 HLRGWIDE 432
            :...||.:
  Rat   334 YFTDWISQ 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 77/265 (29%)
Tryp_SPc 197..430 CDD:214473 75/261 (29%)
Prss47XP_038952282.1 Tryp_SPc 83..342 CDD:238113 77/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.