DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and TPSB2

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:246 Identity:76/246 - (30%)
Similarity:122/246 - (49%) Gaps:32/246 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 EFPWMVGIFTGRQEFL--CGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGS 260
            ::||.|.:....:.::  |||:||||:.|:|.:|.:..:..|....|.   .|...:..|..|..
Human    41 KWPWQVSLRVRDRYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRV---QLREQHLYYQDQLL 102

  Fly   261 RIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLP------PPESPELTNQLLSVTCYA 319
            .:..||:|.:|....:..|||||.|:||:.::.|:..:.||      ||..|          |:.
Human   103 PVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMP----------CWV 157

  Fly   320 TGWGTKEAGSDKL--EHVLKRINLPLVEREECQAKLR---NTRLEARFRLRPSFICAGGDPGKDT 379
            ||||..: ..::|  ...||::.:|::|...|.||..   .|..:.|. :|...:|| |:..:|:
Human   158 TGWGDVD-NDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRI-VRDDMLCA-GNTRRDS 219

  Fly   380 CKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
            |:||.|.||.|::.|   .:...|:||||..||..:.|.:|..|.:...||
Human   220 CQGDSGGPLVCKVNG---TWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 76/246 (31%)
Tryp_SPc 197..430 CDD:214473 74/244 (30%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 76/246 (31%)
Tryp_SPc 31..267 CDD:214473 74/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.