DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and zgc:123295

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:262 Identity:71/262 - (27%)
Similarity:125/262 - (47%) Gaps:29/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NPKGLIPDNDKFPYSEDVSIFGEFPWMVGI----FTGRQEFLCGGTLIHPRLVVTTSHNLVNETV 236
            |..|..|.|.|....::... |.:||.|.:    :.|.   .|||:||:...|::.:| ...:::
Zfish    25 NVCGRAPLNTKIVGGQNAGA-GSWPWQVSLQSPTYGGH---FCGGSLINKDWVLSAAH-CFQDSI 84

  Fly   237 DTLVARAGDWDLNSLNEPYPHQGSR-IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCL 300
            .|::.:.|   |.|.:...|:|.:: :.::|.|..::..|..|||||:.||..:....:|:|:||
Zfish    85 GTIMVKLG---LQSQSGSNPYQITKTVVQVINHPNYNNPSNDNDIALVKLDSSVTFNDYIEPVCL 146

  Fly   301 PPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLR 365
            ....:......|    .:.||||...:.::::..:|:.:.:|:|...:|:.....       .:.
Zfish   147 AAAGNTYAAGTL----SWVTGWGKLSSAANQIPDILQEVEIPIVSHSDCKRAYPG-------EIT 200

  Fly   366 PSFICAG--GDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRG 428
            .:.||||  ...|||:|:||.|.|:..:   ...::...||||:|..||....|.||..|...:.
Zfish   201 SNMICAGLLDQGGKDSCQGDSGGPMVSR---NGSQWIQSGIVSFGRGCAEPGYPGVYARVSQYQD 262

  Fly   429 WI 430
            ||
Zfish   263 WI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 66/241 (27%)
Tryp_SPc 197..430 CDD:214473 64/239 (27%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 65/250 (26%)
Tryp_SPc 36..264 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.