DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and zgc:112038

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:248 Identity:69/248 - (27%)
Similarity:120/248 - (48%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DVSIFGEFPWMVGIF-TGRQEFLCGGTLIHPRLVVTTSH-NLVNETVDTLVARAGDWDLNSLNEP 254
            |.::.|.:||...|. ...::.:|||:||:...|::.:| .::..|.:..:.....:...|    
Zfish    39 DDAVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQFQTGS---- 99

  Fly   255 YPHQGSR-IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCY 318
            .|::.|| :.:|::|.::...:..||||||.|...:....:|:|:||...:|....    ....:
Zfish   100 NPNEISRTLTQIVIHPDYSTTTQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAG----GTKSW 160

  Fly   319 ATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG-GDPGKDTCKG 382
            .|||....:...::.:||:.:.||:|...||.|..:..       :..:.|||| .:.|||.|:|
Zfish   161 ITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGI-------ITDNMICAGINEGGKDACQG 218

  Fly   383 DGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIR 435
            |.|.|:..|   ...|:...||||:|.||.:...|.:|..|...:.||..::|
Zfish   219 DSGGPMVSQ---NGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWITSELR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 67/239 (28%)
Tryp_SPc 197..430 CDD:214473 65/236 (28%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 66/241 (27%)
Tryp_SPc 37..263 CDD:238113 66/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.