DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and prss60.2

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001099071.1 Gene:prss60.2 / 541408 ZFINID:ZDB-GENE-050320-109 Length:328 Species:Danio rerio


Alignment Length:247 Identity:80/247 - (32%)
Similarity:120/247 - (48%) Gaps:30/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 GEFPWMVGIFTGRQ-EFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGS 260
            |.:||.|.:.:.|. ...|||:||....|:|.:|.|...:..:||...|......:|   .|:.|
Zfish    43 GSWPWQVSLQSPRYGGHFCGGSLISSEWVLTAAHCLPGVSESSLVVYLGRRTQQGVN---THETS 104

  Fly   261 R-IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLS--VTCYATGW 322
            | :.:||:||.::.|:..||||||.|...:....:|:|:||      ...|.:.|  .:.:.|||
Zfish   105 RNVAKIIVHSSYNSNTNDNDIALLRLSSAVTFNDYIRPVCL------AAQNSVYSAGTSSWITGW 163

  Fly   323 GTKEAGSD-KLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG-GDPGKDTCKGDGG 385
            |..:||.: ....:|:...:|:|..:.|.|:|.:.      .:..:.|||| ...|||||:||.|
Zfish   164 GDVQAGVNLPAPGILQETMIPVVANDRCNAQLGSG------TVTNNMICAGLAKGGKDTCQGDSG 222

  Fly   386 SPL---FCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434
            .|:   .|.:      :...||.|||..||..:.|.||..|...:.||..||
Zfish   223 GPMVTRLCTV------WIQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 78/244 (32%)
Tryp_SPc 197..430 CDD:214473 76/241 (32%)
prss60.2NP_001099071.1 Tryp_SPc 33..264 CDD:214473 76/241 (32%)
Tryp_SPc 34..267 CDD:238113 78/244 (32%)
Somatomedin_B 296..326 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587381
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.