DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Prss44

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_008764869.1 Gene:Prss44 / 501060 RGDID:1560940 Length:373 Species:Rattus norvegicus


Alignment Length:396 Identity:100/396 - (25%)
Similarity:167/396 - (42%) Gaps:102/396 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 WL------VERTTTVPSTIRNKVSSVLEPPPNESCGQNMECVPRKLCRDNIINDSGISLINPRIS 135
            ||      :.:...||.|:.:     |.|.|:|                |.::|.|   :||:..
  Rat    14 WLLLLQTRLGKAPMVPGTLPS-----LSPLPSE----------------NGLDDPG---VNPQER 54

  Fly   136 PI----QCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIP---------DNDKF 187
            |:    :.|..|        |...|.:|:               :..|..|         ....|
  Rat    55 PLTGMPETSLPL--------KPGGSMTPF---------------DSMGFTPGHSFSSMSLSRQSF 96

  Fly   188 -PYSEDVSIFG---------------EFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETV 236
             |:....|..|               ::||.|.:...:|. :|||:||....|:|.:| .|...:
  Rat    97 PPWIPPTSACGHRTARIVGGKPAPIRKWPWQVSLQVHKQH-ICGGSLISKWWVMTAAH-CVYGHL 159

  Fly   237 DTLVARAGDWDL-NSLNEPYPHQGSRIKEIIMHSEFD-PNSLYNDIALLLLDEPIRLAPHIQPLC 299
            |.:|: .|:.|| :|::...|     :::||:|.::. ..::.:||||:||..|:..:.:|||:|
  Rat   160 DYVVS-MGEADLWSSMSVKIP-----VQDIIVHQDYSVMRTIVHDIALVLLAFPVNYSVNIQPVC 218

  Fly   300 LPPPESPELTNQLLSVTCYATGWG-TKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFR 363
            :  ||...|...  ...|:.|||| |.|.|  :...||:.::|.::..|.|...|::........
  Rat   219 I--PEKSFLVQP--GTLCWVTGWGKTIERG--RSSRVLREVDLSIIRHERCNQILKDITGRIFTL 277

  Fly   364 LRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRG 428
            ::...:|.....|.|.|:||.|.|:.|:.   ...:..|||||||:.|.....|.:|..|.:.|.
  Rat   278 VQEGGVCGYNKKGGDACQGDSGGPMVCEF---NKTWVQVGIVSWGLGCGRIGYPGIYTEVSYYRD 339

  Fly   429 WIDEKI 434
            ||.:::
  Rat   340 WIIKEL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 75/253 (30%)
Tryp_SPc 197..430 CDD:214473 73/250 (29%)
Prss44XP_008764869.1 Tryp_SPc 112..341 CDD:214473 72/245 (29%)
Tryp_SPc 113..341 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.