DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG11313

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:375 Identity:108/375 - (28%)
Similarity:157/375 - (41%) Gaps:72/375 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PNESCGQNMECVPRKLCRDNIINDSGISLINPRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQA 165
            ||:..|.   ||...||   :..:|.::..||..|.::..:. .||...||    |:.|::....
  Fly    27 PNQRTGY---CVNIPLC---VPLNSVLAKSNPTDSEMRFIRE-SRCLVSDQ----SDLPFVCCTP 80

  Fly   166 NFKYKNCGYSNPKG------LIPDND----KFPYSE----DVSIFGEFPWMVGI----FTGRQ-E 211
            :..| |...:.|..      |:||..    ...|::    :.::..||.|||.:    ..|:| .
  Fly    81 DTDY-NTTRARPNDEVIHSTLLPDRSICGGDIAYNQITKGNETVLTEFAWMVLLEYRPHDGQQLR 144

  Fly   212 FLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWD------------------LNSLNEPYPHQ 258
            ..|.|:||:.|.|||.:|.:...|    .||.||..                  ||....|.|.|
  Fly   145 TYCAGSLINNRYVVTAAHCVSAAT----RARKGDVSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQ 205

  Fly   259 GSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWG 323
             ..::||.:|..|.....:|||||:.|...:..:|.|:|:||  |.:..|.|..........|||
  Fly   206 -IAVEEIRIHESFGTRLFWNDIALIRLAREVAYSPSIRPVCL--PSTVGLQNWQSGQAFTVAGWG 267

  Fly   324 ---TKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGG 385
               |.|:...|:     ::.:..||...|:.|..:..:     |..|.:||.|....|:|.||.|
  Fly   268 RTLTSESSPVKM-----KLRVTYVEPGLCRRKYASIVV-----LGDSHLCAEGRSRGDSCDGDSG 322

  Fly   386 SPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIR 435
            .||.....|.   :.|.||||:|:.|.....||||.||.....||.:.||
  Fly   323 GPLMAFHEGV---WVLGGIVSFGLNCGSRFWPAVYTNVLSYETWITQNIR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/261 (31%)
Tryp_SPc 197..430 CDD:214473 80/258 (31%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855 17/61 (28%)
Tryp_SPc 116..367 CDD:238113 82/270 (30%)
Tryp_SPc 116..364 CDD:214473 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.