DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and aqrs

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_651632.2 Gene:aqrs / 43396 FlyBaseID:FBgn0039598 Length:366 Species:Drosophila melanogaster


Alignment Length:231 Identity:57/231 - (24%)
Similarity:79/231 - (34%) Gaps:74/231 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 LCGGTLIHPRLVVTTSH-------NLVNE-TVDTLVARAG-DWDLNSLNEPYPHQGSRIKEIIMH 268
            :|.|.||..|:|||::|       :|:.| |...|....| :.|.|    |.|||     .|...
  Fly    88 ICAGALISRRMVVTSTHCFQPRRFDLIYEYTAKHLSILTGVELDDN----PEPHQ-----VIGFF 143

  Fly   269 SEFDPNSLY-NDIALLLLDEPI-RLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDK 331
            ...:.|..: |.:|||.|...: |......||....|                      :||.| 
  Fly   144 MPVNKNERFTNYVALLALSNKLDRDKYRYIPLHRKKP----------------------QAGDD- 185

  Fly   332 LEHVLKRINLPLVEREECQAKLRNTR------------LEARFRL---RPSFICAGG--DPGKDT 379
                   :.:......:.|.:|.|||            |:..|.:   .|.|||...  ...|.|
  Fly   186 -------VKMAYYGPPKFQIRLYNTRVMDIDRCKIHYGLKEVFHVSTFEPDFICVRNKRHSKKTT 243

  Fly   380 CKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVED 415
            |....|.||.      :|. :|..|..:|..|..:|
  Fly   244 CSTRPGDPLL------IDN-KLAAINIYGEHCDEDD 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 57/231 (25%)
Tryp_SPc 197..430 CDD:214473 57/231 (25%)
aqrsNP_651632.2 Trypsin 82..290 CDD:278516 57/231 (25%)
Tryp_SPc 83..268 CDD:304450 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.