DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG7142

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:372 Identity:83/372 - (22%)
Similarity:142/372 - (38%) Gaps:71/372 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LVERTTTVPSTIRNKVSSVLEPPPNESCGQNMECVPRKLCRDNIINDSGISLINPRISPIQCSKS 142
            |:....::...:.:..|..::.|....||.....   .......:|.:...|:..|||.::..:.
  Fly    12 LLSTIASIMVVLSSASSGSIQLPTVRKCGGGRSA---GAAHTMAMNLAAYGLLENRISTLEAPRQ 73

  Fly   143 LY--RCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGI 205
            .:  :.....::.....:||:|             :.:.:.||.....|                
  Fly    74 THWTKKFLAKREATPHSAPYVV-------------SIQMMTPDQGLVHY---------------- 109

  Fly   206 FTGRQEFLCGGTLIHPRLVVTTSHNLVN-ETVDTLVARAGDWDL-NSLNEPYPHQGSRIKEIIMH 268
                    |.||:|:...::|.:|.|.: :.|:..|..||..|: :...|....|...|...:.|
  Fly   110 --------CAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRH 166

  Fly   269 SEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPES-PELTNQLLSVTCYAT--GWG-TKEAGS 329
            ..:.......||||:...||:....::||..||..:: ||         .|.|  ||| ......
  Fly   167 ELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPE---------GYGTLYGWGNVSMTAV 222

  Fly   330 DKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDP---GKDTCKGDGGSPLF-- 389
            ....|.|:..|:|:::.|.|:..|..:.|.    |..:.:|.|  |   |...|..|.|.||.  
  Fly   223 PNYPHRLQEANMPILDMELCEQILARSGLP----LHETNLCTG--PLTGGVSICTADSGGPLIQQ 281

  Fly   390 -CQMPGEMDRYQLVGIVSWG-VECAVEDIPAVYVNVPHLRGWIDEKI 434
             |:...|.... ::|||||| :.|..::.|:|:|.|.....||::.|
  Fly   282 CCEEHFEQANI-VIGIVSWGKMPCGQKNAPSVFVRVSAFTEWINQVI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 66/248 (27%)
Tryp_SPc 197..430 CDD:214473 64/245 (26%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 72/294 (24%)
Tryp_SPc 84..323 CDD:214473 70/291 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.