DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and ea

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:346 Identity:100/346 - (28%)
Similarity:143/346 - (41%) Gaps:88/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 DSESPYLVKQANFKYKNCGYSNPKGLI--PDNDKFPYSEDV------------------------ 193
            |::..||.:      ..|||:|.|.||  ||..:...||..                        
  Fly    67 DTDRLYLSR------SQCGYTNGKVLICCPDRYRESSSETTPPPKPNVTSNSLLPLPGQCGNILS 125

  Fly   194 -SIFG-------EFPWMVGI-FT---GRQEFLCGGTLIHPRLVVTTSHNLVNETVDT----LVAR 242
             .|:|       |||||..| :|   |::...|||:||..|.|:|.||.:..:.:.|    ...|
  Fly   126 NRIYGGMKTKIDEFPWMALIEYTKSQGKKGHHCGGSLISTRYVITASHCVNGKALPTDWRLSGVR 190

  Fly   243 AGDWDLNSLNE------------PYPHQGSRIKEIIMHSEFDPNS--LYNDIALLLLDEPIRLAP 293
            .|:||.|:..:            | ||....::..|.|.::.|.|  ..||||||.|.:.:....
  Fly   191 LGEWDTNTNPDCEVDVRGMKDCAP-PHLDVPVERTIPHPDYIPASKNQVNDIALLRLAQQVEYTD 254

  Fly   294 HIQPLCLPPPESPELTNQLLS-----VTCYATGWGTKE---AGSDKLEHVLKRINLPLVEREECQ 350
            .::|:|||      |...|.|     :|....|||..|   |.:.||:..::...:     :|||
  Fly   255 FVRPICLP------LDVNLRSATFDGITMDVAGWGKTEQLSASNLKLKAAVEGFRM-----DECQ 308

  Fly   351 AKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQ-LVGIVSWG-VECAV 413
                |........|..:.:||||..|.|:|:||.|.||......:::.|. |.|:||:| ..|.:
  Fly   309 ----NVYSSQDILLEDTQMCAGGKEGVDSCRGDSGGPLIGLDTNKVNTYYFLAGVVSFGPTPCGL 369

  Fly   414 EDIPAVYVNVPHLRGWIDEKI 434
            ...|.||..|.....||...|
  Fly   370 AGWPGVYTLVGKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 84/274 (31%)
Tryp_SPc 197..430 CDD:214473 82/271 (30%)
eaNP_524362.2 CLIP 37..89 CDD:288855 10/27 (37%)
Tryp_SPc 127..386 CDD:214473 83/274 (30%)
Tryp_SPc 128..389 CDD:238113 85/276 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457393
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.