DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG3916

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_650167.1 Gene:CG3916 / 41484 FlyBaseID:FBgn0038003 Length:267 Species:Drosophila melanogaster


Alignment Length:240 Identity:64/240 - (26%)
Similarity:99/240 - (41%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAG--DWDLNSLNEPYPHQGSRIKEIIMHSE 270
            ||.:..|||:::..:.|:|.:|.:....|:.:....|  :|....|..       |:....:|.:
  Fly    53 GRWQHFCGGSIVSGQHVLTAAHCMEKMKVEDVSVVVGTLNWKAGGLRH-------RLVTKHVHPQ 110

  Fly   271 FDPN-SLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLL--------SVTCYATGWG--T 324
            :..| .:.|||||:.:..|.||            |..:::..|:        .|....||||  :
  Fly   111 YSMNPRIINDIALVKVTPPFRL------------ERSDISTILIGGSDRIGEKVPVRLTGWGSTS 163

  Fly   325 KEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLF 389
            ....|..|...|:.:|...:..|:|..|        .||:..:.|||....|:..|.||.|.||.
  Fly   164 PSTSSATLPDQLQALNYRTISNEDCNQK--------GFRVTRNEICALAVQGQGACVGDSGGPLI 220

  Fly   390 CQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434
              .||:..  .||||||:|.....:..|.||..|.....:|.:.|
  Fly   221 --RPGKQP--HLVGIVSYGSSTCAQGRPDVYTRVSSFLPYISQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 63/237 (27%)
Tryp_SPc 197..430 CDD:214473 62/234 (26%)
CG3916NP_650167.1 Tryp_SPc 30..257 CDD:214473 62/234 (26%)
Tryp_SPc 31..260 CDD:238113 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.