DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG17404

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_650165.2 Gene:CG17404 / 41482 FlyBaseID:FBgn0038001 Length:275 Species:Drosophila melanogaster


Alignment Length:290 Identity:73/290 - (25%)
Similarity:116/290 - (40%) Gaps:71/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGI---FTGRQEFLCGGTLIHPRLVVTTSHNLVNE 234
            ||: |..::...| .|..|.|      |:.|.:   ..|.|...|||::|.|..::|.:|.....
  Fly    29 GYT-PHRIVGGAD-IPPGEHV------PYQVSLQYRTRGGQMHFCGGSIIAPNRILTAAHCCQGL 85

  Fly   235 TVDTLVARAGDWDLNSLNEPYPHQGSR--IKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQP 297
            ....:...||   :..|||    :|||  :....:|.::. ..:.:|:|:|.:..|::       
  Fly    86 NASRMSVVAG---IRGLNE----KGSRSQVLSYSIHPKYQ-ELVTSDLAVLSIKPPLK------- 135

  Fly   298 LCLPPPESPELTNQLLSVTCY---------------ATGWGTK------EAGSDKLEHVLKRINL 341
                      |.|..:|...|               .||||.:      ...:....:||:|::.
  Fly   136 ----------LNNSTISAIEYRSQGKDFVGGGVPVTLTGWGLRLPVPFPFLDNVNYPNVLQRMSY 190

  Fly   342 PLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVS 406
            ..:...||    ||..:|:   :..:.|||.| |.:..|.||.|.||..:....:   |.|||||
  Fly   191 HTISNSEC----RNAGMES---VTDTEICARG-PFRGACSGDSGGPLVMESKNGL---QQVGIVS 244

  Fly   407 WG-VECAVEDIPAVYVNVPHLRGWIDEKIR 435
            :| |.|.:...|.||..|.....||..:.:
  Fly   245 YGLVVCGLYISPDVYTRVSTFSDWIGNQTK 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 66/262 (25%)
Tryp_SPc 197..430 CDD:214473 64/259 (25%)
CG17404NP_650165.2 Tryp_SPc 34..269 CDD:214473 68/277 (25%)
Tryp_SPc 35..269 CDD:238113 68/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.