DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG4613

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001261841.1 Gene:CG4613 / 39586 FlyBaseID:FBgn0036427 Length:374 Species:Drosophila melanogaster


Alignment Length:369 Identity:103/369 - (27%)
Similarity:158/369 - (42%) Gaps:64/369 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ERTTTVPSTIRNKVSSVLEPPPNESCGQNMECVPRKLCRDNIINDSGISLINPRI-----SPIQC 139
            ||...:|  :....:|...|||    |...:.:      |::|......:::..:     :|...
  Fly    40 ERLPPLP--VNGSTTSSTGPPP----GVQSDFI------DDLIEGHKQQILSNVLGVASETPSDT 92

  Fly   140 SKSLYRCCAVDQKVDDSESPYLVKQAN----FKYKNCGYSNPKGLIPDNDKFPYSEDVSIFGEFP 200
            :.||     ....:..|.||....:..    |:...|. |...| :|:.::......|.. .::|
  Fly    93 ASSL-----GSTSLSSSASPVFPLEGGGAKAFRVNRCA-SCTCG-VPNVNRIVGGTQVRT-NKYP 149

  Fly   201 WMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEI 265
            |:..|..|...| ||||||:.|.|:|.:|     .|..:..|.....|..|:....|.|......
  Fly   150 WIAQIIRGTFLF-CGGTLINDRYVLTAAH-----CVHGMDMRGVSVRLLQLDRSSTHLGVTRSVA 208

  Fly   266 IMHSE--FDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSV---TCYATGWG-T 324
            ..|:.  :||.||.:|||||.||:||.|...::|.|||       :|.|.:.   .....||| :
  Fly   209 FAHAHVGYDPVSLVHDIALLRLDQPIPLVDTMRPACLP-------SNWLQNFDFQKAIVAGWGLS 266

  Fly   325 KEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG--GDPGKDTCKGDGGSP 387
            :|.||  ...||:.:.:|::...:|:|      ...|..:..:.:|||  ...|:|.|:||.|.|
  Fly   267 QEGGS--TSSVLQEVVVPIITNAQCRA------TSYRSMIVDTMMCAGYVKTGGRDACQGDSGGP 323

  Fly   388 LFCQMPGEMDR-YQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
            |..:     || ::|.|:||:|..||..|.|.||..|.....||
  Fly   324 LIVR-----DRIFRLAGVVSFGYGCAKPDAPGVYTRVSRYLEWI 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 81/243 (33%)
Tryp_SPc 197..430 CDD:214473 79/241 (33%)
CG4613NP_001261841.1 Tryp_SPc 136..362 CDD:214473 80/252 (32%)
Tryp_SPc 137..362 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457468
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.