DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG4477

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_648295.1 Gene:CG4477 / 39058 FlyBaseID:FBgn0035971 Length:315 Species:Drosophila melanogaster


Alignment Length:313 Identity:75/313 - (23%)
Similarity:113/313 - (36%) Gaps:95/313 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FKYKNCGYSNPKGL---------IPDNDKFPYSEDVSIFGEFPWMVGI-------FTGRQEFLCG 215
            |...||...:|:..         :.|.|   :.||......:  .|.:       |.|...| |.
  Fly    15 FPLYNCLGDSPRNAFSSLNRVKRLSDGD---FDEDSIALSNY--CVSLRSRSAEKFFGDNHF-CS 73

  Fly   216 GTLIHPRLVVTTSHNLVNE-----TVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNS 275
            |.::.|..|:|::|.|:|:     :...|:..||     :||        |:|.|       ||.
  Fly    74 GVILAPMFVMTSAHCLINKRRVLISSRVLLIVAG-----TLN--------RLKYI-------PNR 118

  Fly   276 LY------------------NDIALLLLDEPI-RLAPHIQPLCLP--PPESPELTNQLLSVTCYA 319
            .:                  .|..||.:..|. |...||....||  ||        |..:.|..
  Fly   119 TFVTPVTHIWLPDSFTMRNKQDFGLLKVKNPFPRNNEHISIARLPVHPP--------LPGLKCKV 175

  Fly   320 TGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGD---PGKDTCK 381
            .|||....|.....::| .|::.:::.|.|...||...:|        .:||...   ..:..|.
  Fly   176 MGWGRMYKGGPLASYML-YIDVQVIDSEACAKWLRVPSVE--------HVCAVDSDDLTAQQPCG 231

  Fly   382 GDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434
            ||.|:|:       :....:.|||:....|.|..:|::|.||.....||.|||
  Fly   232 GDWGAPM-------LHNGTVYGIVTILAGCGVSHLPSLYTNVHSNANWIHEKI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 64/271 (24%)
Tryp_SPc 197..430 CDD:214473 62/268 (23%)
CG4477NP_648295.1 Tryp_SPc 55..276 CDD:238113 64/265 (24%)
Tryp_SPc 55..273 CDD:214473 62/262 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.