DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and KLKB1

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:431 Identity:121/431 - (28%)
Similarity:188/431 - (43%) Gaps:85/431 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MCLSDERCTSLKRCEDSDDSGRRGIRPRSSRICGTQRVCCEKAQLDSYDRWLVERTTTVPSTIRN 91
            :||       ||..|....|..   .|:.:.|.|...:.|::               |:|....:
Human   266 VCL-------LKTSESGTPSSS---TPQENTISGYSLLTCKR---------------TLPEPCHS 305

  Fly    92 KVSSVLEPPPNESCGQNMECVPRK---LCRDNIINDSGISLINPRISPIQCSKSLYRC-CAVDQK 152
            |:.     |..:..|:.:.....|   :|::..............:.|..|.:.  :| |.:...
Human   306 KIY-----PGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEE--KCKCFLRLS 363

  Fly   153 VDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKFPYSEDVSI-------FGEFPWMVGI---FT 207
            :|.|.:    :.|.....:.|||.......||..........|       :||:||.|.:   .|
Human   364 MDGSPT----RIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLT 424

  Fly   208 GRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVAR------AGDWDLNSLNEPYPHQGSRIKEII 266
            . |..||||:||..:.|:|.:|     ..|.|..:      :|..:|:.:.:..|.  |:|||||
Human   425 A-QRHLCGGSLIGHQWVLTAAH-----CFDGLPLQDVWRIYSGILNLSDITKDTPF--SQIKEII 481

  Fly   267 MHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPP--PESPELTNQLLSVTCYATGWG-TKEAG 328
            :|..:..:...:||||:.|..|:......:|:|||.  ..|...||      |:.|||| :||.|
Human   482 IHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTN------CWVTGWGFSKEKG 540

  Fly   329 SDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAG-GDPGKDTCKGDGGSPLFCQM 392
              :::::|:::|:|||..||||.:.::.::..|      .:||| .:.|||.||||.|.||.|:.
Human   541 --EIQNILQKVNIPLVTNEECQKRYQDYKITQR------MVCAGYKEGGKDACKGDSGGPLVCKH 597

  Fly   393 PGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEK 433
            .|   .::||||.|||..||..:.|.||..|.....||.||
Human   598 NG---MWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEK 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 89/248 (36%)
Tryp_SPc 197..430 CDD:214473 87/245 (36%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519 9/38 (24%)
APPLE 303..386 CDD:128519 15/93 (16%)
Tryp_SPc 401..632 CDD:214473 88/255 (35%)
Tryp_SPc 402..632 CDD:238113 88/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S11393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.