DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG30414

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001163264.1 Gene:CG30414 / 37705 FlyBaseID:FBgn0050414 Length:305 Species:Drosophila melanogaster


Alignment Length:310 Identity:82/310 - (26%)
Similarity:128/310 - (41%) Gaps:74/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NCGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNET 235
            :||.:.|: .||   ......|..:|.. ||||.:.   .|.||||:||..|.|:|.:|.:|:..
  Fly    29 SCGTTKPE-FIP---MITGGADAGLFSN-PWMVKVL---GEKLCGGSLITSRFVLTAAHCIVSTH 85

  Fly   236 VDTLVA------------------------RAGDWDLNSLNEPYPHQGS--------RIKEIIMH 268
            :...:.                        |.|::|..     :|.:..        .:...|:|
  Fly    86 MRVRLGEYKTRFPGKDCSRCVPKSYKLRRIRLGEYDTR-----FPGKDCCVPKSYELAVDRKILH 145

  Fly   269 SEFDPNSLYNDIALLLLDEPIRLAPHIQPLCL----PPPESPELTNQLLSVTCYATGWGTKEAGS 329
            ::::.| |.|||.||.:...::.:.:::|:||    ...|||     :.::    ||||....|:
  Fly   146 ADYNLN-LDNDIGLLRMKSFVQYSDYVRPICLLVEGHMAESP-----IFNI----TGWGVTNDGT 200

  Fly   330 DKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMP- 393
            ....  |:|..:...:...|::|...       ::..|.|||.| ...|.|.||.|.||..|:| 
  Fly   201 PSRR--LQRATVYNTDLHFCRSKFTK-------QVDESQICAAG-TNSDACHGDSGGPLSAQVPF 255

  Fly   394 -GEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKIRGLGIVLQ 442
             |....:| .|:||:| ..|.... :||.||.|.|.||...|.......|
  Fly   256 AGSWLTFQ-YGLVSYG-SAACHSF-SVYTNVTHHRDWIVNAIEDFSRAFQ 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 73/273 (27%)
Tryp_SPc 197..430 CDD:214473 71/270 (26%)
CG30414NP_001163264.1 Tryp_SPc 41..290 CDD:214473 73/280 (26%)
Tryp_SPc 41..290 CDD:238113 73/280 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.