DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG9294

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_995920.1 Gene:CG9294 / 37491 FlyBaseID:FBgn0034666 Length:352 Species:Drosophila melanogaster


Alignment Length:280 Identity:84/280 - (30%)
Similarity:135/280 - (48%) Gaps:26/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 ANFKYKNCGYSNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSH 229
            |||..:....:...|||....|....::..:. ::|||..|.. ...|.|.|:||:...|:|.:|
  Fly    79 ANFPIERDCVTCRCGLINTLYKIVGGQETRVH-QYPWMAVILI-YNRFYCSGSLINDLYVLTAAH 141

  Fly   230 NLVNETVDTLVARAGDWDLNSLNEPYPHQG--SRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLA 292
            .:.....:.:..|..:.:.:..|:....|.  ||:|   :|..::|.|..||:|:|.|::|:.:.
  Fly   142 CVEGVPPELITLRFLEHNRSHSNDDIVIQRYVSRVK---VHELYNPRSFDNDLAVLRLNQPLDMR 203

  Fly   293 PH-IQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNT 356
            .| ::|:|| |.:|....::|..|    .|||.:..|....: .|:.:::.::.:.||    ||.
  Fly   204 HHRLRPICL-PVQSYSFDHELGIV----AGWGAQREGGFGTD-TLREVDVVVLPQSEC----RNG 258

  Fly   357 RLEARFRLRPSFICAG--GDPGKDTCKGDGGSPL---FCQMPGEMDRYQLVGIVSWGVECAVEDI 416
            ......::..:.:|||  .:.|||.|.||.|.||   |.:.||:   |||.|||||||.||....
  Fly   259 TTYRPGQITDNMMCAGYISEGGKDACSGDSGGPLQTTFDEQPGQ---YQLAGIVSWGVGCARPQS 320

  Fly   417 PAVYVNVPHLRGWIDEKIRG 436
            |.||..|.....|:.....|
  Fly   321 PGVYTRVNQYLRWLGSNTPG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 76/243 (31%)
Tryp_SPc 197..430 CDD:214473 75/240 (31%)
CG9294NP_995920.1 Tryp_SPc 100..333 CDD:214473 76/250 (30%)
Tryp_SPc 101..334 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.