DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG8172

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:244 Identity:83/244 - (34%)
Similarity:126/244 - (51%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 FGEFPWMVGIFTGRQEFL-----CGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPY 255
            ||..||.|.:.  :..||     |||.||..|.|:|.:|.:.:.....:..|.|:||:....|..
  Fly   324 FGSHPWQVALI--KSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERL 386

  Fly   256 PHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYAT 320
            .|:...|:...:|..::|....||:||:.||..:....||.|:|| ||.:.:||.::.:|    .
  Fly   387 NHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCL-PPSTTKLTGKMATV----A 446

  Fly   321 GWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNT-RLEARFRLRPSFICAG-GDPGKDTCKGD 383
            |||....|...:..||:.:::.::..:.||...|.. |.||   :...|:||| .|.|:|:|:||
  Fly   447 GWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREA---IHDVFLCAGYKDGGRDSCQGD 508

  Fly   384 GGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDE 432
            .|.||...|.|   |..|:|:||||:.|..|.:|.||.|:.....||::
  Fly   509 SGGPLTLTMDG---RKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/243 (34%)
Tryp_SPc 197..430 CDD:214473 80/239 (33%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 81/240 (34%)
Tryp_SPc 316..555 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.