DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and flz

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001137622.1 Gene:flz / 35902 FlyBaseID:FBgn0286782 Length:1693 Species:Drosophila melanogaster


Alignment Length:389 Identity:110/389 - (28%)
Similarity:172/389 - (44%) Gaps:68/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VERTTTVPSTIRN----KVSSVLEPP----PNESCGQNMECVPRKLCR---DNIINDSGISLINP 132
            |..||..|:|.|.    ||::....|    |.......::.......|   |.|:::.....:||
  Fly  1329 VSTTTRKPATRRTTVAAKVTTTTRRPATKKPTRRVSSTVKTTTVSSARPADDEIVDEEDEEDVNP 1393

  Fly   133 RISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKYKNCGYSNPKGLIPDNDKF--PYSE---- 191
            ..|              |.::|...:......||.:..   :|..:.|...|..|  |.:|    
  Fly  1394 NPS--------------DNEIDQGATLSSYGGANGRKI---HSTSRTLPTPNLAFHSPSTECGVR 1441

  Fly   192 -----------DVSIFGEFPWMV--------GIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVD 237
                       ..|.||.:||.|        |:||..:   |||.||..|.|:|.:| .....:.
  Fly  1442 PHVKSGRIVGGKGSTFGAYPWQVLVRESTWLGLFTKNK---CGGVLITSRYVITAAH-CQPGFLA 1502

  Fly   238 TLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLPP 302
            :|||..|::|::...|........:|.:|:|.::||.:..||:|||.||.|::...||.|:|: |
  Fly  1503 SLVAVMGEFDISGDLESKRSVTKNVKRVIVHRQYDPATFENDLALLELDSPVQFDTHIVPICM-P 1566

  Fly   303 PESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPS 367
            .:..:.|.::.:|    ||||..:.|.. :..||:.:.:|::|...||..........  ::..|
  Fly  1567 NDVADFTGRMATV----TGWGRLKYGGG-VPSVLQEVQVPIIENSVCQEMFHTAGHNK--KILTS 1624

  Fly   368 FICAGGDPG-KDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
            |:|||...| ||:|:||.|.||..|.|.  .||:|.|.||.|::||...:|.||:.....:.|:
  Fly  1625 FLCAGYANGQKDSCEGDSGGPLVLQRPD--GRYELAGTVSHGIKCAAPYLPGVYMRTTFYKPWL 1686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 82/243 (34%)
Tryp_SPc 197..430 CDD:214473 81/241 (34%)
flzNP_001137622.1 PRK14948 <272..452 CDD:237862
PRK11633 <365..>439 CDD:236940
PRK10263 <547..>1005 CDD:236669
PHA03247 <792..1096 CDD:223021
Tryp_SPc 1449..1689 CDD:238113 84/252 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.