DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG5390

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001285802.1 Gene:CG5390 / 34383 FlyBaseID:FBgn0032213 Length:406 Species:Drosophila melanogaster


Alignment Length:414 Identity:155/414 - (37%)
Similarity:221/414 - (53%) Gaps:71/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGTQRVCCEKAQLDSYDRWLVERTTTVPSTIRNKVSSVLEPPP---------------------- 101
            ||.|....:|...|.:      :|...|     |.||  .|||                      
  Fly    16 CGAQDSSLDKLISDIF------KTDETP-----KPSS--PPPPVVNPKDSSGSTGSENGGSSSTQ 67

  Fly   102 NESCGQNMECVPRKLCRDNIINDSGISLINPRI-SPIQCSKSLYRCCAVDQKVDDSESPYLVKQA 165
            .:|||...|||||.||.::.||.||..:|:.|: :..:|...|..||.:..|..|   |.     
  Fly    68 YQSCGDQKECVPRWLCANDTINTSGDGIIDIRLGTDAECKNYLDLCCDLPNKRKD---PI----- 124

  Fly   166 NFKYK-----NCGYSNPKGLIPDNDKFPYSEDV---SIFGEFPWMVGIFTGRQE-----FLCGGT 217
             |::|     .|||.||.|:     .|..:..|   :.|||||||:.|.  |:|     :.|||.
  Fly   125 -FEFKPDHPEGCGYQNPNGV-----GFKITGAVNQEAEFGEFPWMLAIL--REEGNLNLYECGGA 181

  Fly   218 LIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIAL 282
            ||.|.:|:|.:|.:.|:...::|.|||:||..:..|...|:...:||||.|.:|:..|||||:|:
  Fly   182 LIAPNVVLTAAHCVHNKQPSSIVVRAGEWDTQTQTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAV 246

  Fly   283 LLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSD-KLEHVLKRINLPLVER 346
            :||:.|..|..:||.:||     |.:.::.....|||||||..:.|.| :.:.:||::::|:|..
  Fly   247 MLLESPFTLQENIQTVCL-----PNVGDKFDFDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPE 306

  Fly   347 EECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVEC 411
            ::|:..||.|||...|.|..|||||||:..||||||||||||.|.:.|:.:|::..|||:||:.|
  Fly   307 QQCETNLRETRLGRHFILHDSFICAGGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGC 371

  Fly   412 AVEDIPAVYVNVPHLRGWIDEKIR 435
            ...:||.||.:|..||.|||.|::
  Fly   372 GEVNIPGVYASVAKLRPWIDAKLK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 107/241 (44%)
Tryp_SPc 197..430 CDD:214473 104/238 (44%)
CG5390NP_001285802.1 Tryp_SPc 153..391 CDD:238113 106/244 (43%)
Tryp_SPc 153..390 CDD:214473 105/243 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443427
Domainoid 1 1.000 162 1.000 Domainoid score I3893
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 1 1.000 - - mtm8716
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.