DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG18557

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster


Alignment Length:346 Identity:121/346 - (34%)
Similarity:177/346 - (51%) Gaps:59/346 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 CGQNMECVPRKLCRDNIINDSGISLINPRISPIQCSKSLYRCCAVDQKVDDSESPYLVKQANFKY 169
            ||..|||||:.||:.:..|.:.||.  |  ||.|.|:|   ||...||        ||..|..  
  Fly    22 CGLQMECVPQGLCKTSAWNQNAISW--P--SPCQRSES---CCHSSQK--------LVIGAPL-- 69

  Fly   170 KNCGYSNPKGL------IPDNDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTS 228
             |||.|||.||      :.|..| |        .||||.|.:......|...|||:...:|:|.:
  Fly    70 -NCGKSNPNGLGGTVEEVVDQAK-P--------NEFPWTVALMQNLINFFGAGTLVTENIVITAA 124

  Fly   229 HNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIK-----EIIMHSEFDPNSLYNDIALLLLDEP 288
            |.::::|::......|.|||..|      .|..|:     .|:.|.:|:..:..|:|||::|:..
  Fly   125 HLMLDKTINDFGIIGGAWDLKQL------AGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETS 183

  Fly   289 IRLAPHIQPLCLPPPESPELTNQLLSVT-----CYATGWGTKEAGSDKLEHVLKRINLPLVEREE 348
            ..:.|.|.|:|.|..          .|:     |...|||..:..:....:..|:|:||:|.|.:
  Fly   184 FVMKPPIGPICWPTS----------GVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSD 238

  Fly   349 CQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAV 413
            |::.||.|.....|:|.|:.:||||:.|:|.|.|||||||.|.:||....|:|||||:.|..|.:
  Fly   239 CESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGL 303

  Fly   414 EDIPAVYVNVPHLRGWIDEKI 434
            |::||:|.|:.|:|.||::::
  Fly   304 ENVPALYTNISHMRPWIEKQL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 85/245 (35%)
Tryp_SPc 197..430 CDD:214473 83/242 (34%)
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 88/259 (34%)
Tryp_SPc 90..320 CDD:214473 85/254 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457420
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4490
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.