DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG4259

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001259904.1 Gene:CG4259 / 33385 FlyBaseID:FBgn0031389 Length:270 Species:Drosophila melanogaster


Alignment Length:285 Identity:80/285 - (28%)
Similarity:124/285 - (43%) Gaps:45/285 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 LVKQANFKYKNCGY-------SNPKGLIPDNDKFPYSEDVSIFGEFPWMVGIFTGRQ---EFLCG 215
            ::...|.:|.|...       |||:                  ..|||:|.:...|.   .::..
  Fly    12 IISLVNSQYFNYNQIRRETYGSNPR------------------ATFPWVVSVLDQRDWLFRYIGV 58

  Fly   216 GTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDI 280
            |:||:|.:|:|.:|.|...|...||.|||:|| .|......|....:..|:.|.:|:..:..|::
  Fly    59 GSLINPNVVLTAAHILNGTTKYDLVVRAGEWD-TSTTADQQHVDLEVLNIVSHEQFNRFNAENNM 122

  Fly   281 ALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVE 345
            |||:|.....:..:|..:.|...|:     .:...:|:..|||.....|.....|||.:.:.|:.
  Fly   123 ALLILVSAFEMTANINLIPLYLQEA-----GIQKGSCFFNGWGKVYLNSTDYPTVLKTVQVDLLS 182

  Fly   346 REECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVE 410
            ...|.::          :|....||..|..|.| |.||||:||.|::.....:|..||||:|..:
  Fly   183 MGMCSSR----------KLPIQQICGKGLEGID-CSGDGGAPLVCRILTYPYKYAQVGIVNWLSQ 236

  Fly   411 CAVEDIPAVYVNVPHLRGWIDEKIR 435
            ..||:...|:.||..|..|||..:|
  Fly   237 KPVENTFIVFTNVAGLLPWIDYHLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 73/238 (31%)
Tryp_SPc 197..430 CDD:214473 70/235 (30%)
CG4259NP_001259904.1 Tryp_SPc 39..259 CDD:238113 73/236 (31%)
Tryp_SPc 39..256 CDD:214473 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003848
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.