DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and Ser6

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:259 Identity:66/259 - (25%)
Similarity:112/259 - (43%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 NDKFPYSEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSHNLVNETVDTLVA------- 241
            |.:....|| ::..:||..|.: .......|||:::....::|.:|.:.||.|:.::.       
  Fly    29 NGRVVGGED-AVKNQFPHQVSL-RNAGSHSCGGSILTRTYILTAAHCVSNEDVNHVITPIAAERF 91

  Fly   242 --RAGDWDLNSLNEPYPHQGS---RIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPLCLP 301
              |||..|..|        |.   ::.|:|:|.|:  .:..||:|||.|:.|:.|:..|||:.||
  Fly    92 TIRAGSNDRFS--------GGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSASIQPIDLP 146

  Fly   302 PPESPELTNQLLSVTCYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRP 366
            ..::|...:.::|      |||..:...| |...|:...|..:.|::|: :|.:...|..     
  Fly   147 TVDTPADVDVVIS------GWGRIKHQGD-LPRYLQYNTLKSITRQQCE-ELIDFGFEGE----- 198

  Fly   367 SFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVPHLRGWI 430
              :|.........|.||.|.|       .:...||||:..:.|:......|..|..|.:.:.||
  Fly   199 --LCLLHQVDNGACNGDSGGP-------AVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 63/246 (26%)
Tryp_SPc 197..430 CDD:214473 61/244 (25%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 63/255 (25%)
Tryp_SPc 32..256 CDD:238113 65/256 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.