DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG14227

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_608345.2 Gene:CG14227 / 32978 FlyBaseID:FBgn0031058 Length:286 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:115/284 - (40%) Gaps:62/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 CGYSNPKGLIPDNDK------FPYSEDVSIFGEFPWMVG-IFTGRQEFLCGGTLIHPRLVVTTSH 229
            ||.|     :|.|.|      |..|.|:.   ..||:|. |..|:.:  |.|:||:.|.|:|.:|
  Fly    31 CGRS-----LPTNAKLTWWNYFDSSTDIQ---ANPWIVSVIVNGKAK--CSGSLINHRFVLTAAH 85

  Fly   230 NLVNETVDTLVARAGDWDLNSLNEPYPHQGS------------RIKEIIMHSEFDP-NSLYNDIA 281
            .:..|.:.   ...||:|..:     |.|..            ||.:.|:|:.|.. .:...||.
  Fly    86 CVFREAMQ---VHLGDFDAWN-----PGQNCSSGARLSNAYCVRIDKKIVHAGFGKIQAQQYDIG 142

  Fly   282 LLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSV--TCYATGWGTKEAGSDKLEHVLKRINLPLV 344
            ||.:...::.:..::|:||       |.|:.::.  ....|.|||.......:..|||......:
  Fly   143 LLRMQHAVQYSDFVRPICL-------LINEPVAAIDRFQLTVWGTTAEDFRSIPRVLKHSVGDRI 200

  Fly   345 EREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQM--PGEMDRYQLVGIVSW 407
            :||.|..|.:.       ::..|.||...:. ...||||.|.|...::  .|....:|. ||:.:
  Fly   201 DRELCTLKFQQ-------QVDESQICVHTET-SHACKGDSGGPFSAKILYGGTYRTFQF-GIIIF 256

  Fly   408 GV-ECAVEDIPAVYVNVPHLRGWI 430
            |: .||.   .:|..||.....||
  Fly   257 GLSSCAG---LSVCTNVTFYMDWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 65/253 (26%)
Tryp_SPc 197..430 CDD:214473 63/251 (25%)
CG14227NP_608345.2 Tryp_SPc 57..277 CDD:214473 63/248 (25%)
Tryp_SPc 57..277 CDD:238113 63/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.