DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8586 and CG9673

DIOPT Version :9

Sequence 1:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:267 Identity:65/267 - (24%)
Similarity:110/267 - (41%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 GLIPDNDKFPY-----SEDVSIFGEFPWMVGIFTGRQEFLCGGTLIHPRLVVTTSH-----NLVN 233
            |||...:..|.     .|||: .||:||...:...:.. :|.|.:|....::|.:|     .:..
  Fly    16 GLILSAEASPQGRILGGEDVA-QGEYPWSASVRYNKAH-VCSGAIISTNHILTAAHCVSSVGITP 78

  Fly   234 ETVDTLVARAGDWDLNSLNEPYPHQGSRIKEIIMHSEFDPNSLYNDIALLLLDEPIRLAPHIQPL 298
            ....||..|.|     ::|:........:|.:|:|..:  .:..:|||:|.|||.:..:..||.:
  Fly    79 VDASTLAVRLG-----TINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFSDRIQDI 136

  Fly   299 CLPP---PESPELTNQLLSVT-CYATGWGTKEAGSDKLEHVLKRINLPLVEREECQAKLRNTRLE 359
            .|||   .|:.::..:|.:.| .|..|||....|:...:.  ::.|...:.|..|:       .|
  Fly   137 ALPPTTDEETEDVDAELPNGTPVYVAGWGELSDGTASYKQ--QKANYNTLSRSLCE-------WE 192

  Fly   360 ARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQLVGIVSWGVECAVEDIPAVYVNVP 424
            |.:... |.:|.....|:..|:||.|:.:.      .|...|.|:.|:.........|.|...|.
  Fly   193 AGYGYE-SVVCLSRAEGEGICRGDAGAAVI------DDDKVLRGLTSFNFGPCGSKYPDVATRVS 250

  Fly   425 HLRGWID 431
            :...||:
  Fly   251 YYLTWIE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 58/244 (24%)
Tryp_SPc 197..430 CDD:214473 56/241 (23%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 59/252 (23%)
Tryp_SPc 29..259 CDD:238113 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.